Ummm, Pepperhil... "eeeew"!

Anyway... the term 'wake' (as it pertains to a funeral) came about because they had little knowledge of medicine. They would actually bury people alive, but in a comatose state. They decided to lay the person out in the house, and took turns by the body to see if they would 'wake'.

LOL actually that was something I read in an email. Glad I didn't quote the other one that would really make you go "eww"

I know that I have heard many fascinating random facts.....just can't think of any. Mind has gone blank

The durian is the favorite fruit of tigers. In fact, it is the only fruit they eat.

Mineral oil with added fragrance is marketed as baby oil in the US, UK and Canada
Mineral oil or liquid petrolatum is a by-product in the distillation of petroleum to produce gasoline. It is a transparent, colorless oil composed mainly of alkanes (typically 15 to 40 carbons) [1] and cyclic paraffins, related to white petrolatum. Mineral oil is a substance of relatively low value, and it is produced in very large quantities. Mineral oil is available in light and heavy grades, and can often be found in drug stores.

Serviceberries, the fruit of the Amelanchier sp. trees got their common name because they are one of the first to bloom in northern climates and when they bloom it is a sign that the ground is thawed enough to dig a grave and have services for those that died in the winter whose frozen bodies were stored until the ground was thawed.

Ahhh, my random thought inspired further random facts

The word "lethologica" describes the state of not being able to remember the word you want

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch is the name of a town in Wales. It has the longest place name in Europe, the longest railway station name in the world, and the world's longest internet domain name (http://www.llanfairpwllgwyngyllgogerychwyrndrobwyll-llantysiliogogogoch.com). In English the name means 'St Mary's Church in a hollow of the white hazel near to the rapid whirlpool and St Tysil's Church of the red cave.'

It can't claim to have the world's longest place name because that honour goes to the city of Bangkok, Thailand, whose full official name is Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit. (Try and say that in one breath)

The English translation of that name is:

The great city of angels, the supreme unconquerable land of the great immortal divinity (Indra),the royal capital of nine noble gems, the pleasant city,with plenty of grand royal palaces and divine paradises for the reincarnated deity (Vishnu),
given by Indra and created by the god of crafting (Visnukarma).

Souns like an advertisement for their tourism department!

Scientific fact!
Having Children is hereditary. Research has shown that.... if your parents didn't have children, then there is no possible way you could have children!

In Florida it is illegal to sing in a public place while attired in a swimsuit

oh my god!!! i was on the floor when i read this!! thats scary...do you think its true?